>gi|111221123|ref|YP_711917.1| putative oxidoreductase [Frankia alni ACN14a] [18-20] MPTWRAGPHPAAFTGPELAACVRAVREPVHLLAVPGRGVGLGLGGDVGAGDPAAPVVVGT . . YP_711917.1 FRAAL1675 primary YP_711917.1 4233174 alternate YP_711917.1 111221123 alternate YP_711917.1 YP_711917.1 alternate YP_711917.1 111221123 . Gene ID, GI, Start, End, COG. 1146882, 111221123, 1796237, 1797832. 1146883, 111221124, 1797890, 1805209. Matched gene pairs (maximum matching pairs are . 7 Apr 2009 . Canon EOS 350D 1/10s f/2.8 at 100.0mm iso800 full exif. other sizes: small medium original. previous | next. Type your message and click Add .
2 Black, 211211, b Findlay 8 Best, 12111312, b Taylor , ..12 Williams, 111221123, b Taylor .. . " ..14 Holmes, 1111, not out 4 Extras 16 Total 116 Bowling .
14 Karat Club in Honolulu, HI - AOL Local Yellow PagesAOL Local Yellow Pages provides the latest detailed business information for 14 Karat Club, located in Honolulu, HI.File Format: Microsoft Excel - View as HTML. putative oxidoreductase|PID:111221123|Gene:-|Strand:plus|Class:-|COG:-|Position:1.1796237..1797832 76.2568306010929 25.5737704918033 19.8907103825137 . rhinelandernorth NR, 10/03/2008 11:46 AM, 111221123, Seller. A+: I won this item on a Wednesday, paid for it within 15 minutes of winning and had the barrel .
Image title: new horse arrival. Complete exposure details. Dimensions: 633 x 428, 56 kB. Dimensions of original: 1664 x 1125, 304 kB. Display this image: . . NOS: 0.9460 putative oxidoreductase|PID:111221123|Gene:-|Strand:plus|Class:-|COG:-|Position:1.1796237..1797832 CAI: 0.592 NOS: 0.3210 Modular polyketide .
. type I polyketide synthase 1796237..1797832 + 531 111221123 - FRAAL1675 - COG2070R putative oxidoreductase 1797890..1805209 + 2439 111221124 - FRAAL1676 . E8GH0AB01AQ0Z4_B' (111221088 36 111221123 1) 4 'chr7'=='+E8GH0AB01AQ0Z4.E8GH0AB01AQ0Z4_B' (66669709 1 66669744 36) 4 'chr15'=='+E8GH0AB01AQ0Z4. . File Format: KML Document - View on Google Maps111221123 · 111221124 · 111221125 · 111221126 · 111221127 · 111221128 · 111221129 · 111221130 · 111221131 · 111221132 · 111221133 · 111221134 · 111221135 . 2001 Ford F150. Thank you for visiting Durham Auto Mart of Durham, NC, powered by Carsforsale.com. Quality used cars and trucks. Check out our inventory and . . 00222 121000482331137021 36541242 1 100829317773 1121122362114 119011111111235111111122 3 2 211223 32221211 2200829111212121 111221123 2112123129212112 . . W02853+02150+214921198+00728+0028626125011 W02848+03102+147021149+01084+0028426529006 W02848+04077+111221123+01456+0028623822007 . File Format: PDF/Adobe Acrobat - Quick View111221121, -, putative molybdenum binding protein. 111221122, -, Putative type I polyketide synthase. 111221123, -, putative oxidoreductase . ACCESSION YP_711917 VERSION YP_711917.1 GI:111221123 DBLINK Project:17403 DBSOURCE REFSEQ: accession NC_008278.1 KEYWORDS . SOURCE Frankia alni ACN14a . gi|111221001|ref|YP_711795.1|, 2.2e-09, 375-615, FMN-linked oxidoreductases. gi|111221123|ref|YP_711917.1|, 5.85e-19, 67-343, FMN-linked oxidoreductases . File Format: PDF/Adobe Acrobat - Quick View. type I polyketide synthase FRAAL1675/gi|111219505|ref|NC_008278.1| 1796237-1797832 + YP_711917.1 GI:111221123;GeneID:4233174 - putative oxidoreductase . . 2 11211122 11 111 111122222211 123311 111 1111 11 1111111111 111111111 1 +136 1 1 1111 1 1121 11211 1 1111111 11 111221123 111 21111 121122122212211121 . Process of Razing Old Jail Begins in Richland County, SC . find Knight Ridder/Tribune Business News articles. By John C. Drake, The State, Columbia, . TradeMe.co.nz - Mazda RX7 TYPE R 1999 - New Zealand.Female, 27,; Member Since: Jul 2009; Location: Philippines; Last Login: 2 weeks; sharon's URL: http://profiles.friendster.com/111221123. More about sharon .